} { { ] "context" : "lia-deleted-state", "action" : "rerender" { }, ] "eventActions" : [ } ] }, ], "action" : "pulsate" { { }); "action" : "rerender" "useCountToKudo" : "false", ], ], { } { "context" : "", } }, }, } "context" : "", ] }, "actions" : [ ] { } { var keycodes = { { "event" : "unapproveMessage", "action" : "rerender" element.removeClass('active'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ] } ] { } ] { "action" : "rerender" } "actions" : [ "context" : "", "parameters" : { "action" : "rerender" $('li.close-on-click').on('click',resetMenu); "action" : "pulsate" "event" : "unapproveMessage", } "context" : "", "context" : "", }, "action" : "rerender" "kudosable" : "true", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); { { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, } } Voraussetzung ist, dass du bei deinem alten Anbieter vorab die Freigabe deiner Rufnummer beantragt hast. }, ] "event" : "ProductAnswerComment", ] "}); }, { "context" : "lia-deleted-state", }, "action" : "rerender" "eventActions" : [ } $(document).keydown(function(e) { { "accessibility" : false, "actions" : [ "message" : "1624221", { { "action" : "rerender" ] "context" : "", "revokeMode" : "true", }, "context" : "", "selector" : "#messageview_1", "event" : "removeMessageUserEmailSubscription", "useTruncatedSubject" : "true", "actions" : [ { }, } //} else { } "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "initiatorBinding" : true, "actions" : [ ] "actions" : [ { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { { ] "context" : "envParam:selectedMessage", { { "actions" : [ "context" : "", "context" : "", "event" : "removeMessageUserEmailSubscription", { "context" : "", } return; "event" : "QuickReply", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", { ] "context" : "", "actions" : [ "actions" : [ "action" : "rerender" "event" : "unapproveMessage", { "disableKudosForAnonUser" : "false", "accessibility" : false, "actions" : [ "actions" : [ { }, "event" : "approveMessage", { ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "parameters" : { "componentId" : "forums.widget.message-view", { } } { "showCountOnly" : "false", { "actions" : [ "dialogKey" : "dialogKey" { { { ] "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } { } } }, "actions" : [ "context" : "", Execute whatever should happen when entering the right sequence ] } } }, ich habe heute eine n Mobilfunkvertrag bei Mobilcom-Debitel. var key = e.keyCode; { "context" : "", { "parameters" : { "actions" : [ "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", { { $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); { ] }, "event" : "ProductAnswerComment", "context" : "", "disableKudosForAnonUser" : "false", "actions" : [ } }, { "actions" : [ } "showCountOnly" : "false", { "dialogKey" : "dialogKey" }, "actions" : [ "context" : "", $(this).removeAttr('href'); { ] "event" : "MessagesWidgetEditCommentForm", "linkDisabled" : "false" { "context" : "", "event" : "addMessageUserEmailSubscription", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1624232 .lia-rating-control-passive', '#form_4'); { ] } "action" : "rerender" "event" : "kudoEntity", } "event" : "RevokeSolutionAction", "truncateBody" : "true", ;(function($) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useCountToKudo" : "false", element.find('li').removeClass('active'); "event" : "markAsSpamWithoutRedirect", }, { "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", })(LITHIUM.jQuery); "selector" : "#messageview_5", "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" "disallowZeroCount" : "false", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "revokeMode" : "true", { "displayStyle" : "horizontal", "initiatorDataMatcher" : "data-lia-message-uid" "quiltName" : "ForumMessage", "action" : "rerender" "initiatorBinding" : true, { { } // console.log('watching: ' + key); "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "action" : "rerender" "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "eventActions" : [ } } "action" : "rerender" ] var key = e.keyCode; "action" : "rerender" { "action" : "rerender" }, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1623645 .lia-rating-control-passive', '#form'); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, }, "actions" : [ "action" : "rerender" { } }); { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" } } { "displayStyle" : "horizontal", ] "event" : "markAsSpamWithoutRedirect", "actions" : [ } if ( count == neededkeys.length ) { { { ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "pulsate" ] "useTruncatedSubject" : "true", ] "action" : "rerender" "linkDisabled" : "false" }, "action" : "rerender" "dialogKey" : "dialogKey" "event" : "MessagesWidgetMessageEdit", "selector" : "#messageview_2", .attr('aria-hidden','true') "initiatorDataMatcher" : "data-lia-kudos-id" { { } "showCountOnly" : "false", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" $('section.header-announcement').slideUp(); ] $(this).next().toggle(); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", } ] }, ] "componentId" : "forums.widget.message-view", "actions" : [ "event" : "MessagesWidgetAnswerForm", Bist du sicher, dass du fortfahren möchtest? var watching = false; "dialogKey" : "dialogKey" "action" : "rerender" if ( neededkeys[count] == key ) { Was muss man für eine Portierung machen? "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", } LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_7decdd7b2b285","nodesModel":{"Archiv_Mobilfunk|forum-board":{"title":"Board-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_7decdd7b2b285_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ } "actions" : [ } "event" : "approveMessage", "event" : "editProductMessage", ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); if ( count == neededkeys.length ) { { "context" : "envParam:selectedMessage", }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ;(function($) { "actions" : [ { { { "truncateBodyRetainsHtml" : "false", "event" : "deleteMessage", "actions" : [ }, "context" : "envParam:quiltName", { "event" : "MessagesWidgetEditAction", "actions" : [ "activecastFullscreen" : false, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({